DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg7 and Uba1

DIOPT Version :9

Sequence 1:NP_611350.1 Gene:Atg7 / 37141 FlyBaseID:FBgn0034366 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_477310.2 Gene:Uba1 / 35998 FlyBaseID:FBgn0023143 Length:1191 Species:Drosophila melanogaster


Alignment Length:223 Identity:56/223 - (25%)
Similarity:94/223 - (42%) Gaps:58/223 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 ISQTKCLLFGAGTLGCAVARNLLSWGFKHITLLDSGKVGFSNPVRQNLYTHADAVAGNRMKATTA 401
            ::.:..||.|.|.||..:|:|::..|.|.|||.|:...|..:...|...|.|| :..||.:|:.|
  Fly   215 MANSDILLSGLGGLGLEIAKNVILGGVKSITLHDTATCGLHDLSSQFYLTEAD-IGKNRAEASCA 278

  Fly   402 AQRLKEINPSAETAGYVLEIPMPGHT--IGESLLAQTK---------EHLKVIEKLVQDHDVIFL 455
              :|.|:|      .||..:   .||  :.|..|.:.:         |..:.|.|...::.:..:
  Fly   279 --QLAELN------NYVRTV---SHTGPLTEEFLRKFRVVVLTNSDGEEQQRIAKFAHENGIALI 332

  Fly   456 LTDSR-----------ESRWLPTLLGAAKEKIVINAALGFDSYLVM------RHGTTRKEAGDDG 503
            :.::|           ||..:....|......:| |::..|:..|:      |||.      :||
  Fly   333 IAETRGLFAKVFCDFGESFTIYDQDGTQPISTMI-ASITHDAQGVVTCLDETRHGF------NDG 390

  Fly   504 -----QEIEGLKCINGDQ------LGCY 520
                 .|::|::.:||.|      ||.|
  Fly   391 DYVTFSEVQGMQELNGCQPLKITVLGPY 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg7NP_611350.1 ATG7_N 9..303 CDD:293029
E1_like_apg7 11..682 CDD:273590 56/223 (25%)
Apg7 341..658 CDD:238763 56/219 (26%)
Uba1NP_477310.2 Ube1 194..1188 CDD:273603 56/223 (25%)
Ube1_repeat1 199..574 CDD:238768 56/223 (25%)
E1_4HB 447..510 CDD:292809
Ube1_repeat2 606..1144 CDD:238767
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446862
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10953
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.