DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg7 and Uba1

DIOPT Version :9

Sequence 1:NP_611350.1 Gene:Atg7 / 37141 FlyBaseID:FBgn0034366 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_001014102.1 Gene:Uba1 / 314432 RGDID:1359327 Length:1058 Species:Rattus norvegicus


Alignment Length:423 Identity:85/423 - (20%)
Similarity:140/423 - (33%) Gaps:173/423 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 QLLADEGKELLADMCSGGALRDP-----SLLTRF--FVLSFADLKCHSY----YYWFAFPCPLTP 150
            ||..|.|:|::....:|   ..|     |::|:.  .|::..|...|.:    :..|:       
  Rat   197 QLFCDFGEEMVLTDSNG---EQPLSAMVSMVTKDNPGVVTCLDEARHGFETGDFVSFS------- 251

  Fly   151 TLKLQGAVQ-----------------KLRDLPNSSSYI-------------MALKALPTESQNFF 185
              ::||.||                 .:.|..|.|.||             ::.|:||.      
  Rat   252 --EVQGMVQLNGCQPIEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLPA------ 308

  Fly   186 ILYANVEKNIFEARSLSSLDDKNVEFCYFGFADPSEYEHPAWIMRNYAAFLLQQCPSFVGKP--- 247
                          ||:..|        |...|.::|..||.:...:.| |.|.|......|   
  Rat   309 --------------SLAEPD--------FVMTDFAKYSRPAQLHIGFQA-LHQFCAQHNRPPRPR 350

  Fly   248 -------LKFLGLRHN-------QQMNIDDSLVWKVIQTEACDLSQSENIKFVG----WELNK-- 292
                   |..|....|       ||.|:|:.|:.|:....|.||:...  .|:|    .|:.|  
  Rat   351 NEEDATELVTLAQAVNARSPPAVQQDNVDEDLIRKLAYVAAGDLAPIN--AFIGGLAAQEVMKAC 413

  Fly   293 NGKMGPRMVCMRDSMDPAKLAENSVNLNLKLMKW------RLVPDLNLEIISQTKCL-------- 343
            :||..|                        :|:|      ..:|: :.|.:::.|||        
  Rat   414 SGKFMP------------------------IMQWLYFDALECLPE-DKEALTEDKCLPRQNRYDG 453

  Fly   344 -------------------LFGAGTLGCAVARNLLSWGF-----KHITLLDSGKVGFSNPVRQNL 384
                               |.|||.:||.:.:|....|.     ..:.:.|...:..||..||.|
  Rat   454 QVAVFGSDLQEKLGKQKYFLVGAGAIGCELLKNFAMIGLGCGEGGEVVVTDMDTIEKSNLNRQFL 518

  Fly   385 YTHADAVAGNRMKATTAAQRLKEINPSAETAGY 417
            :...|.   .::|:.|||..::::||..:...:
  Rat   519 FRPWDV---TKLKSDTAAAAVRQMNPYIQVTSH 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg7NP_611350.1 ATG7_N 9..303 CDD:293029 57/269 (21%)
E1_like_apg7 11..682 CDD:273590 85/423 (20%)
Apg7 341..658 CDD:238763 24/109 (22%)
Uba1NP_001014102.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46
Ube1 49..1055 CDD:273603 85/423 (20%)
2 approximate repeats. /evidence=ECO:0000255 63..611 85/423 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.