Sequence 1: | NP_611350.1 | Gene: | Atg7 / 37141 | FlyBaseID: | FBgn0034366 | Length: | 684 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001094049.1 | Gene: | Uba2 / 308508 | RGDID: | 1312023 | Length: | 639 | Species: | Rattus norvegicus |
Alignment Length: | 204 | Identity: | 49/204 - (24%) |
---|---|---|---|
Similarity: | 79/204 - (38%) | Gaps: | 43/204 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 335 EIISQTKCLLFGAGTLGCAVARNLLSWGFKHITLLDSGKVGFSNPVRQNLYTHADAVAGNRMKAT 399
Fly 400 TAAQRLKEINPSAETAGYVLEIPMPGHTIGESLLAQTKEHLKVIEKLVQDHDVIFLLTDSRESRW 464
Fly 465 LPTLLGAAKEKIVINAALGFDSYLVMRHGTTRKEAGDDGQEIEGLKCINGDQLGCYFCN----DV 525
Fly 526 TAPGNSLKD 534 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Atg7 | NP_611350.1 | ATG7_N | 9..303 | CDD:293029 | |
E1_like_apg7 | 11..682 | CDD:273590 | 49/204 (24%) | ||
Apg7 | 341..658 | CDD:238763 | 47/198 (24%) | ||
Uba2 | NP_001094049.1 | ThiF | 9..>175 | CDD:279270 | 49/200 (25%) |
Uba2_SUMO | 19..443 | CDD:238766 | 47/198 (24%) | ||
UAE_UbL | 451..537 | CDD:291402 | |||
UBA2_C | 548..634 | CDD:292812 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0476 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |