DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg7 and Uba2

DIOPT Version :9

Sequence 1:NP_611350.1 Gene:Atg7 / 37141 FlyBaseID:FBgn0034366 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_001094049.1 Gene:Uba2 / 308508 RGDID:1312023 Length:639 Species:Rattus norvegicus


Alignment Length:204 Identity:49/204 - (24%)
Similarity:79/204 - (38%) Gaps:43/204 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 EIISQTKCLLFGAGTLGCAVARNLLSWGFKHITLLDSGKVGFSNPVRQNLYTHADAVAGNRMKAT 399
            |.:|..:.|:.|||.:||.:.:||:..||.||.|:|...:..||..||.|:.....   .|.||.
  Rat    13 EAVSGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHV---GRSKAQ 74

  Fly   400 TAAQRLKEINPSAETAGYVLEIPMPGHTIGESLLAQTKEHLKVIEKLVQDHDVIFLLTDSRESRW 464
            .|.:.:.:.:|.|....:...|..|.:.:                :..:...::....|:|.:| 
  Rat    75 VAKESVLQFHPQANIEAHHDSIMNPDYNV----------------EFFRQFILVMNALDNRAAR- 122

  Fly   465 LPTLLGAAKEKIVINAALGFDSYLVMRHGTTRKEAGDDGQEIEGLKCINGDQLGCYFCN----DV 525
                      ..|....|..|..|: ..||    ||..||    :..|......||.|:    ..
  Rat   123 ----------NHVNRMCLAADVPLI-ESGT----AGYLGQ----VTTIKKGVTECYECHPKPTQR 168

  Fly   526 TAPGNSLKD 534
            |.||.::::
  Rat   169 TFPGCTIRN 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg7NP_611350.1 ATG7_N 9..303 CDD:293029
E1_like_apg7 11..682 CDD:273590 49/204 (24%)
Apg7 341..658 CDD:238763 47/198 (24%)
Uba2NP_001094049.1 ThiF 9..>175 CDD:279270 49/200 (25%)
Uba2_SUMO 19..443 CDD:238766 47/198 (24%)
UAE_UbL 451..537 CDD:291402
UBA2_C 548..634 CDD:292812
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.