DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg7 and Sae1

DIOPT Version :9

Sequence 1:NP_611350.1 Gene:Atg7 / 37141 FlyBaseID:FBgn0034366 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_001012063.1 Gene:Sae1 / 308384 RGDID:1306098 Length:349 Species:Rattus norvegicus


Alignment Length:309 Identity:62/309 - (20%)
Similarity:106/309 - (34%) Gaps:74/309 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 ENSVNLNLKLMKWRLVPDLNLEIISQTKCLLFGAGTLGCAVARNLLSWGFKHITLLDSGKVGFSN 378
            |.:...:.::..|.|.....|.   .::.|:.|...||..:|:||:..|.|.:|:||..:|...:
  Rat    17 EEAAQYDRQIRLWGLEAQKRLR---ASRVLIVGMKGLGAEIAKNLILAGVKGLTMLDHEQVSPED 78

  Fly   379 PVRQNLYTHADAVAGNRMKATTAAQRLKEINPSAETAGYVLEIPMPGHTIGESLLAQTKEHLKVI 443
            ...|.| ....:|..||.:|  :.:|.:.:||..:                  :...|::..|..
  Rat    79 LGAQFL-IRTGSVGQNRAEA--SLERAQNLNPMVD------------------VKVDTEDIEKKP 122

  Fly   444 EKLVQDHDVIFLLTDSRESRWLPTLLGAAKEKIVI--------NAALGFDSYLVMRHGTTRKEAG 500
            |....:.|.:.|...|::              ::|        |:...|...:...||.|....|
  Rat   123 ESFFTEFDAVCLTCCSKD--------------VIIKVDQICHRNSIKFFTGDVFGYHGYTFANLG 173

  Fly   501 DDGQEIEGLKCINGDQLGCYFCNDVTAPGNSLKDRTLD-QQCTVTR------PGVSNIAASYAVE 558
            :.....|..|.....|        ....|...|...|| .:.|:.:      |....:|..::.|
  Rat   174 EHEFVEEKTKVTKVSQ--------GVEDGPDAKRAKLDSSETTMVKKKVLFCPVKEALAVDWSGE 230

  Fly   559 LLVALLQHPRKELAPAYY---------AQSGRGRSEETEEKVPEGLLGI 598
            ...|.|    |..||.|:         ...||..:.::..:..|.||.|
  Rat   231 KAQAAL----KRTAPDYFLLQVLLKFRTDKGRDPTSDSYSEDAELLLQI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg7NP_611350.1 ATG7_N 9..303 CDD:293029
E1_like_apg7 11..682 CDD:273590 62/309 (20%)
Apg7 341..658 CDD:238763 58/282 (21%)
Sae1NP_001012063.1 Aos1_SUMO 19..344 CDD:238769 61/307 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.