DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg7 and Uba5

DIOPT Version :9

Sequence 1:NP_611350.1 Gene:Atg7 / 37141 FlyBaseID:FBgn0034366 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_001009669.1 Gene:Uba5 / 300968 RGDID:1311702 Length:403 Species:Rattus norvegicus


Alignment Length:319 Identity:58/319 - (18%)
Similarity:109/319 - (34%) Gaps:77/319 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 KLAENSVNLN-----LKLMKWRLVPDLNLEIISQTKCLLFGAGTLGCAVARNLLSWGFKHITLLD 370
            |:::..|:.|     :.|.:..:|.|  .|.|......:.|.|.:|...|..|...|...:.|.|
  Rat    40 KMSDEVVDSNPYSRLMALKRMGVVSD--YEKIRTYAVAIVGVGGVGSVTAEMLTRCGIGKLLLFD 102

  Fly   371 SGKVGFSNPVRQNLYTHADAVAGNRMKATTAAQRLKEINPSA--ETAGYVLEIPMPGHTIGESLL 433
            ..||..:|..|.....:...::    |...|...|:.|||..  |...|.:              
  Rat   103 YDKVELANMNRLFFQPYQAGMS----KVQAAEHTLRSINPDVLFEVHNYNI-------------- 149

  Fly   434 AQTKEHLKVIEKLV--------QDHDVIFLLTDSRESRWLPTLLGAAKEKIVINAALGFDSYLVM 490
             .|.||.:.....:        |..|::....|:.|:|            :.||.|..       
  Rat   150 -TTVEHFEHFMNRISNGGLEEGQPVDLVLSCVDNFEAR------------MAINTACN------- 194

  Fly   491 RHGTTRKEAGDDGQEIEG-LKCINGDQLGCYFCNDVTAPGNSLKDRTLDQQ--CTVTRPGVSNIA 552
            ..|.|..|:|.....:.| ::.:...:..|:.|.......:::.::||.::  |..:.|....:.
  Rat   195 ELGQTWMESGVSENAVSGHIQLMVPGESACFACAPPLVVASNIDEKTLKREGVCAASLPTTMGVV 259

  Fly   553 ASYAVELLVALL-----------QHPRKELAPAYYAQSG--------RGRSEETEEKVP 592
            |...|:.::..|           .:..::..|..:.:..        |.:.||.:::.|
  Rat   260 AGILVQNVLKFLLKFGTVSFYLGYNAMQDFFPTMFMKPNPQCDDKNCRKQQEEYKKRAP 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg7NP_611350.1 ATG7_N 9..303 CDD:293029
E1_like_apg7 11..682 CDD:273590 58/319 (18%)
Apg7 341..658 CDD:238763 50/284 (18%)
Uba5NP_001009669.1 ThiF_MoeB_HesA_family 50..293 CDD:238386 51/282 (18%)
ThiF 51..307 CDD:279270 51/295 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..337 4/13 (31%)
UFM1-interacting sequence (UIS). /evidence=ECO:0000250|UniProtKB:Q9GZZ9 333..345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.