DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg7 and MOCS3

DIOPT Version :9

Sequence 1:NP_611350.1 Gene:Atg7 / 37141 FlyBaseID:FBgn0034366 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_055299.1 Gene:MOCS3 / 27304 HGNCID:15765 Length:460 Species:Homo sapiens


Alignment Length:300 Identity:72/300 - (24%)
Similarity:118/300 - (39%) Gaps:79/300 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 RMVCMRDSMDPAKLAENSVNLNLKLMKWRLVPDLNL--EIISQTKC-LLFGAGTLGCAVARNLLS 360
            |:|.:......|.|:.:.:   |:..:..::|:|.:  ::...|.| |:.|.|.|||.:|:.|.:
Human    42 RLVPVSPLPPKAALSRDEI---LRYSRQLVLPELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAA 103

  Fly   361 WGFKHITLLDSGKVGFSNPVRQNLYTHADAVAGNRMKATTAAQRLKEINPSAETAGYVLEIPMPG 425
            .|...:.|:|...|..||..||.|  |.:|:|| :.||.:||..|:.:|.:.|...|.       
Human   104 AGVGRLGLVDYDVVEMSNLARQVL--HGEALAG-QAKAFSAAASLRRLNSAVECVPYT------- 158

  Fly   426 HTIGESLLAQTKEHLKVIEKLVQDHDVIFLLTDSRESRWLP----TLLGAAKEKIVINAALGFDS 486
                ::|...|      ...||:.:||:...:|:..:|:|.    .|.|   ..:|..:||.|:.
Human   159 ----QALTPAT------ALDLVRRYDVVADCSDNVPTRYLVNDACVLAG---RPLVSASALRFEG 210

  Fly   487 YLVMRH----------------GTTRKEAGDDG------------QEIEGLKCING--------- 514
            .:.:.|                ..|.....|.|            |.:|.||...|         
Human   211 QITVYHYDGGPCYRCIFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSL 275

  Fly   515 ---DQLGCYFCNDVTAPGNSLKDRTLDQQCTVTRPGVSNI 551
               |.|..:|      ....|:.|.||......||.|:::
Human   276 LLFDALRGHF------RSIRLRSRRLDCAACGERPTVTDL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg7NP_611350.1 ATG7_N 9..303 CDD:293029 2/3 (67%)
E1_like_apg7 11..682 CDD:273590 72/299 (24%)
Apg7 341..658 CDD:238763 64/255 (25%)
MOCS3NP_055299.1 ThiF_MoeB_HesA_family 62..285 CDD:238386 59/245 (24%)
RHOD_ThiF 327..460 CDD:238784
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.