Sequence 1: | NP_611350.1 | Gene: | Atg7 / 37141 | FlyBaseID: | FBgn0034366 | Length: | 684 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_766300.1 | Gene: | Uba6 / 231380 | MGIID: | 1913894 | Length: | 1053 | Species: | Mus musculus |
Alignment Length: | 305 | Identity: | 53/305 - (17%) |
---|---|---|---|
Similarity: | 96/305 - (31%) | Gaps: | 114/305 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 331 DLNLEIISQTKCLLFGAGTLGCAVARNLLSWGFKHITLLDSGK-----VGFSNPVRQNLYTHADA 390
Fly 391 VAGNRMKATTAAQRLKEINPSAETAG--------------------YVLEIPM------------ 423
Fly 424 ----------PGHTIGESLLAQTKEHLKVIEKLVQDHDVIFLLTDSRESRWLPTLLGAAKEKIVI 478
Fly 479 NAALGFDSYLVMRHGTTRKEAGDDGQEIEGLKCINGDQLGCYFCNDVTAPGNSLKDRTLDQQCTV 543
Fly 544 TRP-----------------GVS---NIAASYAVELLVALLQHPR 568 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Atg7 | NP_611350.1 | ATG7_N | 9..303 | CDD:293029 | |
E1_like_apg7 | 11..682 | CDD:273590 | 53/305 (17%) | ||
Apg7 | 341..658 | CDD:238763 | 52/295 (18%) | ||
Uba6 | NP_766300.1 | Ube1 | 38..1046 | CDD:273603 | 53/305 (17%) |
Ube1_repeat1 | 43..432 | CDD:238768 | 53/305 (17%) | ||
E1_4HB | 299..362 | CDD:292809 | 5/12 (42%) | ||
Ube1_repeat2 | 462..1005 | CDD:238767 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0476 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |