DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg7 and Uba6

DIOPT Version :9

Sequence 1:NP_611350.1 Gene:Atg7 / 37141 FlyBaseID:FBgn0034366 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_766300.1 Gene:Uba6 / 231380 MGIID:1913894 Length:1053 Species:Mus musculus


Alignment Length:305 Identity:53/305 - (17%)
Similarity:96/305 - (31%) Gaps:114/305 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 DLNLEIISQTKCLLFGAGTLGCAVARNLLSWGFKHITLLDSGK-----VGFSNPVRQNLYTHADA 390
            |..::.::::...|.|.|.||..:|:||:..|.|.:|:.|:.|     :|      .|.:...|.
Mouse    53 DTAMQKMAKSCVFLSGMGGLGVEIAKNLVLAGIKALTIHDTKKCQAWDLG------TNFFLCEDD 111

  Fly   391 VAGNRMKATTAAQRLKEINPSAETAG--------------------YVLEIPM------------ 423
            |...|.:|.....|:.|:||..:.:.                    .:.||.:            
Mouse   112 VVNERNRAEAVLHRIAELNPYVQVSSSSAPLDETTDLSFLEKYQCVVLTEIKLTLQKKINNFCHS 176

  Fly   424 ----------PGHTIGESLLAQTKEHLKVIEKLVQDHDVIFLLTDSRESRWLPTLLGAAKEKIVI 478
                      ..|.|...|.....:..:|.:...::...||:...::.:..:.|.|.:...|:..
Mouse   177 HCPPIKFISADVHGIWSRLFCDFGDEFEVSDTTGEEPKEIFISNITQANPGIVTCLESHPHKLET 241

  Fly   479 NAALGFDSYLVMRHGTTRKEAGDDGQEIEGLKCINGDQLGCYFCNDVTAPGNSLKDRTLDQQCTV 543
            ...|.|                   :||.|:..:||..                      ||.||
Mouse   242 GQFLTF-------------------REIHGMTGLNGSV----------------------QQITV 265

  Fly   544 TRP-----------------GVS---NIAASYAVELLVALLQHPR 568
            ..|                 |::   ....::..|.|.:.::|||
Mouse   266 ISPFSFSIGDTTKLDPYLHGGIAVQVKTPKTFCFEPLESQIKHPR 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg7NP_611350.1 ATG7_N 9..303 CDD:293029
E1_like_apg7 11..682 CDD:273590 53/305 (17%)
Apg7 341..658 CDD:238763 52/295 (18%)
Uba6NP_766300.1 Ube1 38..1046 CDD:273603 53/305 (17%)
Ube1_repeat1 43..432 CDD:238768 53/305 (17%)
E1_4HB 299..362 CDD:292809 5/12 (42%)
Ube1_repeat2 462..1005 CDD:238767
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.