DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg7 and SAE1

DIOPT Version :9

Sequence 1:NP_611350.1 Gene:Atg7 / 37141 FlyBaseID:FBgn0034366 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_005491.1 Gene:SAE1 / 10055 HGNCID:30660 Length:346 Species:Homo sapiens


Alignment Length:298 Identity:61/298 - (20%)
Similarity:105/298 - (35%) Gaps:52/298 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 ENSVNLNLKLMKWRLVPDLNLEIISQTKCLLFGAGTLGCAVARNLLSWGFKHITLLDSGKVGFSN 378
            |.:...:.::..|.|.....|.   .::.||.|...||..:|:||:..|.|.:|:||..:|...:
Human    14 EEAAQYDRQIRLWGLEAQKRLR---ASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPED 75

  Fly   379 PVRQNLYTHADAVAGNRMKATTAAQRLKEINPSAETAGYVLEIPMPGHTIGESLLAQTKEHLKVI 443
            |..|.| ....:|..||.:|  :.:|.:.:||..:                  :...|::..|..
Human    76 PGAQFL-IRTGSVGRNRAEA--SLERAQNLNPMVD------------------VKVDTEDIEKKP 119

  Fly   444 EKLVQDHDVIFLLTDSRESRWLPTLLGAAKEKIVI--------NAALGFDSYLVMRHGTTRKEAG 500
            |......|.:.|...||:              :::        |:...|...:...||.|....|
Human   120 ESFFTQFDAVCLTCCSRD--------------VIVKVDQICHKNSIKFFTGDVFGYHGYTFANLG 170

  Fly   501 DDGQEIEGLKCINGDQLGCYFCNDVTAPGNSLKDRTLDQQCTVTRPGVSNIAASYAVELLVALLQ 565
            :.....|..|.....| |.....|.........:.|:.::..|..|....:...::.|...|.|:
Human   171 EHEFVEEKTKVAKVSQ-GVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALK 234

  Fly   566 HPRK-----ELAPAYYAQSGRGRSEETEEKVPEGLLGI 598
            ....     ::...:....||..|.:|.|:..|.||.|
Human   235 RTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg7NP_611350.1 ATG7_N 9..303 CDD:293029
E1_like_apg7 11..682 CDD:273590 61/298 (20%)
Apg7 341..658 CDD:238763 57/271 (21%)
SAE1NP_005491.1 Aos1_SUMO 16..341 CDD:238769 60/296 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.