DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg7 and UBA2

DIOPT Version :9

Sequence 1:NP_611350.1 Gene:Atg7 / 37141 FlyBaseID:FBgn0034366 Length:684 Species:Drosophila melanogaster
Sequence 2:XP_005258461.2 Gene:UBA2 / 10054 HGNCID:30661 Length:752 Species:Homo sapiens


Alignment Length:270 Identity:56/270 - (20%)
Similarity:104/270 - (38%) Gaps:70/270 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KALDKLQL-LAD--EGKELLADMCSGGALRDPSLLTRFFVLSFADLKCH-------SYYYWFAFP 145
            |:::.|:: ||:  :|.||:.|.      .|||.:.  ||.|.|:|:.|       |.:...:..
Human   436 KSIETLRVHLAEKGDGAELIWDK------DDPSAMD--FVTSAANLRMHIFSMNMKSRFDIKSMA 492

  Fly   146 CPLTPTLK-----------------LQGAVQKLRDL-----PNSSSYIMALKALPTESQNFFILY 188
            ..:.|.:.                 |.|.:.:.|.:     ||....::...||...:.|.::..
Human   493 GNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNKQPNPRKKLLVPCALDPPNPNCYVCA 557

  Fly   189 A----NVEKNIFEARSLSSLDDKNVEFCYFGFADPSEYEHPAWIMRNYAAFLLQ----QCPSFVG 245
            :    .|..|:.:...| :|.||.|:..:...|...:.|.      .....|:.    :..:...
Human   558 SKPEVTVRLNVHKVTVL-TLQDKIVKEKFAMVAPDVQIED------GKGTILISSEEGETEANNH 615

  Fly   246 KPLKFLGLRHNQQMNIDD-----SLVWKVIQTEACDLSQSENIKFVGWELNKNGKMGPRMVCMRD 305
            |.|...|:|:..::..||     :|:..::.:|  ||.:....:.||   :...|:||     :.
Human   616 KKLSEFGIRNGSRLQADDFLQDYTLLINILHSE--DLGKDVEFEVVG---DAPEKVGP-----KQ 670

  Fly   306 SMDPAKLAEN 315
            :.|.||...|
Human   671 AEDAAKSITN 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg7NP_611350.1 ATG7_N 9..303 CDD:293029 52/256 (20%)
E1_like_apg7 11..682 CDD:273590 56/270 (21%)
Apg7 341..658 CDD:238763
UBA2XP_005258461.2 Uba2_SUMO 159..556 CDD:238766 27/127 (21%)
UBA_e1_thiolCys 291..474 CDD:287545 15/45 (33%)
UAE_UbL 564..650 CDD:291402 18/94 (19%)
UBA2_C 661..747 CDD:292812 7/25 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.