DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and Lgals3

DIOPT Version :9

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_114020.1 Gene:Lgals3 / 83781 RGDID:69356 Length:262 Species:Rattus norvegicus


Alignment Length:101 Identity:29/101 - (28%)
Similarity:43/101 - (42%) Gaps:20/101 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LCTAKSTVDPNA-----------DIGLRFSCYFRND---VIVRNSRINGAWGEEESHVMDPNTLP 86
            |.|...||.|||           ||...|:..|..:   |||.|::.:..||.||      ....
  Rat   143 LITIIGTVKPNANSITLNFKKGNDIAFHFNPRFNENNRRVIVCNTKQDNNWGREE------RQSA 201

  Fly    87 NPIVSGEFFLVYILCCEDSFAISINSREFCRFRYRM 122
            .|..||:.|.:.:|...|.|.:::|.....::.:||
  Rat   202 FPFESGKPFKIQVLVEADHFKVAVNDVHLLQYNHRM 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 5..140 CDD:278752 29/101 (29%)
GLECT 172..297 CDD:238025
Lgals3NP_114020.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..102
Bindin 18..>116 CDD:251078
9 X 9 AA tandem repeats of Y-P-G-X(3)-P-[GS]-[AG] 35..112
GLECT 129..256 CDD:238025 29/101 (29%)
Beta-galactoside binding. /evidence=ECO:0000250 193..199 4/11 (36%)
Nuclear export signal. /evidence=ECO:0000250 238..253 29/101 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.