DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and si:dkey-95h12.1

DIOPT Version :9

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_001334297.2 Gene:si:dkey-95h12.1 / 794350 ZFINID:ZDB-GENE-060503-85 Length:754 Species:Danio rerio


Alignment Length:134 Identity:37/134 - (27%)
Similarity:55/134 - (41%) Gaps:15/134 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSHPLEF---GHVLEVVAKTIDGAARFHINLCTAKSTVDPNADIGLRFSCYFRNDVIVR---NSR 67
            |:.|.|:   ..|..::..||:|......|......:..|:....:.||  |..|...|   ||.
Zfish   616 LTVPCEYLLDNGVYNMMIITINGKVNADANQFVVDLSKGPDIACHVNFS--FSEDGNPRIGCNSL 678

  Fly    68 INGAWGEEESHVMDPNTLPNPIVSGEFFLVYILCCEDSFAISINSREFCRFRYRM-PLGTIRALE 131
            |...||:||..|...:     ...|..|.:.|||....|.:::|......|::|: .|..||.:.
Zfish   679 IGSIWGKEERGVSSFH-----FFRGMPFEMKILCTNTEFQVTVNGSHLMNFKHRIQELDQIRGIG 738

  Fly   132 I-RD 134
            | ||
Zfish   739 IYRD 742

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 5..140 CDD:278752 37/134 (28%)
GLECT 172..297 CDD:238025
si:dkey-95h12.1XP_001334297.2 FN3 501..592 CDD:238020
Gal-bind_lectin 626..749 CDD:214904 34/124 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.