DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and lgalsla

DIOPT Version :9

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001038765.1 Gene:lgalsla / 723995 ZFINID:ZDB-GENE-060616-24 Length:164 Species:Danio rerio


Alignment Length:139 Identity:34/139 - (24%)
Similarity:59/139 - (42%) Gaps:16/139 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FAGNLSHPLEFGHVLEVVAKTIDGAARFHINL-CTAKSTVDPNADIGLRFSCYFRNDVIVRNSRI 68
            |.|.:...|..|..:.::.........|.|:| |..       ||:.|.....|....|:||:.:
Zfish    37 FCGGIRGGLRPGKKITIMGVVSADPDSFDISLTCGC-------ADVALDMCVRFEEREILRNACV 94

  Fly    69 NGAWGEEESHVMDPNTLPN-PIVSGEFFLVYILCCEDSFAISINSREFCRFRYR-MPLGTIRALE 131
            :..||:||      .::|. |.::.:.|.|.|.|....|.:.::..:...|.:| |||..|..::
Zfish    95 SDQWGDEE------RSIPYFPFIAEQPFRVEIHCEHPRFLVLVDGHQLFDFYHRVMPLNAIDTIQ 153

  Fly   132 IRDQIQVIK 140
            |...:.:.|
Zfish   154 ISGSLTITK 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 5..140 CDD:278752 33/137 (24%)
GLECT 172..297 CDD:238025
lgalslaNP_001038765.1 Gal-bind_lectin 43..164 CDD:214904 32/133 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.