DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and LGALS7B

DIOPT Version :10

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001035972.1 Gene:LGALS7B / 653499 HGNCID:34447 Length:136 Species:Homo sapiens


Alignment Length:123 Identity:36/123 - (29%)
Similarity:59/123 - (47%) Gaps:9/123 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GHVLEVVAKTIDGAARFHINLCTAKSTVDPNADIGLRFSCYFRNDVIVRNSRINGAWGEEESHVM 80
            |.||.:.......|:|||:||...:   :..:|..|.|:.......:|.||:..|:||.||   .
Human    17 GTVLRIRGLVPPNASRFHVNLLCGE---EQGSDAALHFNPRLDTSEVVFNSKEQGSWGREE---R 75

  Fly    81 DPNTLPNPIVSGEFFLVYILCCEDSFAISINSREFCRFRYRMPLGTIRALEIRDQIQV 138
            .|..   |...|:.|.|.|:..:|.|...:...::..||:|:||..:|.:|:...:|:
Human    76 GPGV---PFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQL 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 12..140 CDD:459768 36/123 (29%)
GLECT 172..297 CDD:238025
LGALS7BNP_001035972.1 Gal-bind_lectin 11..133 CDD:214904 36/123 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.