DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and LGALS14

DIOPT Version :10

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_982297.1 Gene:LGALS14 / 56891 HGNCID:30054 Length:168 Species:Homo sapiens


Alignment Length:106 Identity:25/106 - (23%)
Similarity:50/106 - (47%) Gaps:13/106 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RFHINLCTAKSTVDPNADIGLRFSCYFRNDVIVRNSRINGAWG-EEESHVMDPNTLPNPIVSGEF 94
            :..:|..|.   :|.::||..:|..:|.:..|: ||.:.|.|. ||:.:.:       |...|:.
Human    64 QLEVNFYTG---MDEDSDIAFQFRLHFGHPAIM-NSCVFGIWRYEEKCYYL-------PFEDGKP 117

  Fly    95 FLVYILCCEDSFAISINSREFCRFRYRMPLGTIRALEI-RD 134
            |.:.|......:.:.:|.:....|.:|.|..:::.|:: ||
Human   118 FELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRD 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 12..140 CDD:459768 25/106 (24%)
GLECT 172..297 CDD:238025
LGALS14NP_982297.1 Gal-bind_lectin 40..165 CDD:459768 25/106 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.