Sequence 1: | NP_611349.2 | Gene: | CG5335 / 37140 | FlyBaseID: | FBgn0034365 | Length: | 321 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005173755.1 | Gene: | lgals4 / 567193 | ZFINID: | ZDB-GENE-141222-13 | Length: | 2601 | Species: | Danio rerio |
Alignment Length: | 350 | Identity: | 87/350 - (24%) |
---|---|---|---|
Similarity: | 127/350 - (36%) | Gaps: | 81/350 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 FAGNLSHPLEFGHVLEVVAKTIDGAARFHINLCTAKSTVDPNADIGLRFSCYFRNDVIVRNSRIN 69
Fly 70 GAWGEEESHVMDPNTLPNPIVSGEFFLVYILCCEDSFAISINSREFCRFRYRMPLGTIRALEIRD 134
Fly 135 QIQV--------------IKQVDHRTVFPN------PWPAVHASDYFKAFSNDQP---------- 169
Fly 170 ----------ILFSPGHVIVLTARCFEN-KKGQFIIKFMDSDTKREELHFSVRFDEKAVVRNSMN 223
Fly 224 KNFEFGSEERHGGFPFVFNQQFKLALAFTEREVLTAVDGYNFFSYTWRTP---NAMMNLVGFKVT 285
Fly 286 SINGLVV-------QITGVDHLQTG 303 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5335 | NP_611349.2 | Gal-bind_lectin | 5..140 | CDD:278752 | 40/148 (27%) |
GLECT | 172..297 | CDD:238025 | 35/135 (26%) | ||
lgals4 | XP_005173755.1 | Gal-bind_lectin | 22..149 | CDD:278752 | |
GLECT | 216..340 | CDD:238025 | |||
Gal-bind_lectin | 389..518 | CDD:278752 | |||
Gal-bind_lectin | 528..655 | CDD:278752 | |||
Gal-bind_lectin | 703..830 | CDD:278752 | |||
Gal-bind_lectin | 840..967 | CDD:278752 | |||
Gal-bind_lectin | 1013..1142 | CDD:278752 | |||
Gal-bind_lectin | 1152..1279 | CDD:278752 | |||
Gal-bind_lectin | 1325..1454 | CDD:278752 | |||
Gal-bind_lectin | 1464..1591 | CDD:278752 | 40/135 (30%) | ||
Gal-bind_lectin | 1642..1766 | CDD:278752 | 36/134 (27%) | ||
Gal-bind_lectin | 1776..1903 | CDD:278752 | 2/8 (25%) | ||
Gal-bind_lectin | 1949..2073 | CDD:278752 | |||
Gal-bind_lectin | 2122..2246 | CDD:278752 | |||
GLECT | 2295..2422 | CDD:238025 | |||
Gal-bind_lectin | 2468..2593 | CDD:278752 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D357844at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |