DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and lgals8a

DIOPT Version :9

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_003200715.1 Gene:lgals8a / 563573 ZFINID:ZDB-GENE-040724-22 Length:316 Species:Danio rerio


Alignment Length:318 Identity:82/318 - (25%)
Similarity:136/318 - (42%) Gaps:61/318 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FAGNLSHPLEFGHVLEVVAKTIDGAARFHINLCTAKSTVDPNADIGLRFSCYF-RNDVIVRNSRI 68
            :.|.:...|:.|.::.:......|:.||.::| |..|::.|.||:...|:..| |:..||.|:..
Zfish    17 YIGTILGGLQPGEMVLIQGTVPSGSDRFQVDL-TCGSSMKPRADVAFHFNPRFTRSPYIVCNTLQ 80

  Fly    69 NGAWGEEESHVMDPNTLPNPIVSGEFFLVYILCCEDSFAISINSREFCRFRYRMPLGTIRALEIR 133
            ...||:||.|.:      .|...|..|.:.||..:|.|.:::|......:|.|:.|..:..|.|.
Zfish    81 KERWGKEEIHYL------MPFSHGAAFEIIILVQKDLFKVAVNGSHLLEYRQRVELKKVDTLNIS 139

  Fly   134 DQIQV-----IKQVDHRT-VFPN-------PWPAVHASDYFKAFSNDQPILF--------SPGHV 177
            .::|:     |...:.:: |.|:       |.|....|:     |.|..:.|        |||..
Zfish   140 GKVQIQAIGFIPSSESKSPVMPSNAVASKRPQPYSVMSE-----SGDTSLPFRSKLAKGLSPGDS 199

  Fly   178 IVLTARCFENKKGQ-------FIIKFMDSDTKREELHFSVRFDEKAVVRNSMNKNFEFGSEE--- 232
            |::        |||       |.:....|:::....|.:.||...:.||||..:.. :||||   
Zfish   200 IMV--------KGQIPGSPHSFAVNLRISNSEDIACHLNPRFKTGSFVRNSFLRGC-WGSEEVSL 255

  Fly   233 -RHGGFPFVFNQQFKLALAFTEREVLTAVDGYNFFSYTWRTPNAMMNLVGFKVTSING 289
             |   |||...:.|::.:....:|...||:|::..||..|    :.:|....|..|.|
Zfish   256 PR---FPFSPGEYFEMIILCEAQEFKVAVNGFHQLSYKHR----VQDLSSVDVLEIMG 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 5..140 CDD:278752 37/140 (26%)
GLECT 172..297 CDD:238025 37/137 (27%)
lgals8aXP_003200715.1 Gal-bind_lectin 23..147 CDD:214904 36/130 (28%)
Gal-bind_lectin 193..314 CDD:214904 36/130 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4988
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.