DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and lgals3a

DIOPT Version :9

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001373725.1 Gene:lgals3a / 557373 ZFINID:ZDB-GENE-030131-7667 Length:368 Species:Danio rerio


Alignment Length:113 Identity:35/113 - (30%)
Similarity:45/113 - (39%) Gaps:35/113 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 QPIL--------FSPGHVIVLTARCFENKKGQFIIKFMDSDTKREELHFSVRFDEKAVVRNSMNK 224
            :||:        |..||.:|                          .||:.||.|..|||||...
Zfish   258 EPIIGGDRFHVDFMRGHEVV--------------------------FHFNPRFHENTVVRNSQLG 296

  Fly   225 NFEFGSEERHGGFPFVFNQQFKLALAFTEREVLTAVDGYNFFSYTWRT 272
            .. :|.|||.||||||..:||:|.:.........||||.:...:..||
Zfish   297 GL-WGPEEREGGFPFVQGRQFELKILVETDGFKVAVDGVHLLEFEHRT 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 5..140 CDD:278752
GLECT 172..297 CDD:238025 33/101 (33%)
lgals3aNP_001373725.1 PRK07764 <11..158 CDD:236090
Gal-bind_lectin 246..362 CDD:214904 35/113 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X133
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.