DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and lgals9l4

DIOPT Version :9

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001034900.1 Gene:lgals9l4 / 556717 ZFINID:ZDB-GENE-060312-19 Length:281 Species:Danio rerio


Alignment Length:299 Identity:74/299 - (24%)
Similarity:125/299 - (41%) Gaps:53/299 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FAGNLSHPLEFGHVLEVVAKTIDGAARFHINLCTAKSTVDPNADIGLRFS-CYFRNDV----IVR 64
            |.|.|...|:.|..|.::.:.:..|..|.:||..|...   ..||.|.|. |:   ||    ||.
Zfish    16 FIGPLLGGLQEGKTLIIIGRVLPNADIFGVNLQHAAKC---GTDIALHFKPCF---DVGPAHIVF 74

  Fly    65 NSRINGAWGEEESHVMDPNTLPNPIVSGEFFLVYILCCEDSFAISINSREFCRFRYRMPLGTIRA 129
            |:...|.||.||....       |.|.|:.|.:.|...::::.:|:|.:....:::|:|...:..
Zfish    75 NTFEKGNWGPEEKSTC-------PFVKGQPFTLEIHVTKEAYKVSVNGQHLADYKHRIPFTLVDT 132

  Fly   130 LEIRDQIQVIKQVDHRTVFPNPWPAVHASDYFKAFSNDQPILFSPGHVIVL-------TARCFEN 187
            :    .:.::.::|. ..:..|     .:..:|...:|.   ...|..||:       :.|...|
Zfish   133 I----LVPLMVELDF-IAYQKP-----VTVPYKTLISDG---LQSGKDIVIHGVPKADSDRMTFN 184

  Fly   188 KKGQFIIKFMDSDTKREELHFSVRFDEKAVVRNSMNKNFEFGSEERHGGFPFVFNQQFKLALAFT 252
            .:.::.|.|          |:..|||:.|||||:. :|.::|:||:||..||:..|.|::.::..
Zfish   185 LRHRYGIAF----------HYQCRFDQNAVVRNTW-ENGKWGAEEKHGPVPFIRGQFFQVKISCH 238

  Fly   253 EREVLTAVDGYNFFSYTWRTPNAMMNLVGFKVTSINGLV 291
            .......|:|.....|..|    ...|....|..|.|.|
Zfish   239 SDHYDVFVNGKQTHIYKHR----FTELEDIDVFEIRGNV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 5..140 CDD:278752 35/139 (25%)
GLECT 172..297 CDD:238025 35/127 (28%)
lgals9l4NP_001034900.1 Gal-bind_lectin 22..144 CDD:214904 33/139 (24%)
Gal-bind_lectin 161..279 CDD:214904 35/131 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.