DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and lgals4.1

DIOPT Version :9

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001011449.1 Gene:lgals4.1 / 496937 XenbaseID:XB-GENE-992854 Length:327 Species:Xenopus tropicalis


Alignment Length:112 Identity:39/112 - (34%)
Similarity:59/112 - (52%) Gaps:15/112 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DGAARFHINLCTAKSTVDPNADIGLRFSCYFRNDVIVRNSRINGAWGEEESHVMDPNTLPNPIVS 91
            :||.|||||.....|.     |:.|.|:.....:|:|||||:.|:||:||.     |...||...
 Frog   220 EGAERFHINFKAGSSN-----DVALHFNPRLTENVVVRNSRLGGSWGQEER-----NLSYNPFRP 274

  Fly    92 GEFFLVYILCCEDSFAISINSREFCRFRYRMPLGTIRALEIRDQIQV 138
            |::|.:.|.|..|.|.:.:|.:.||.|.:|..:     .::.|:|:|
 Frog   275 GQYFDISIRCGMDRFTVFVNGQHFCDFAHRYSM-----FQMLDRIEV 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 5..140 CDD:278752 39/112 (35%)
GLECT 172..297 CDD:238025
lgals4.1NP_001011449.1 GLECT 18..149 CDD:238025
Gal-bind_lectin 203..326 CDD:214904 39/112 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I9354
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.