DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and Pex23

DIOPT Version :10

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_730508.1 Gene:Pex23 / 40229 FlyBaseID:FBgn0288469 Length:1350 Species:Drosophila melanogaster


Alignment Length:50 Identity:13/50 - (26%)
Similarity:24/50 - (48%) Gaps:1/50 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 TGGGAGAKFHGKVAHAKDKKSNVS-LKKGKGSVAQKKMLASKLKAAMKQK 363
            ||.|.|....||......::.::| |:....:.|:|::.|..|..:..|:
  Fly   132 TGTGQGFDMPGKRLGGLSRQPSLSFLRATAATAAEKRVRAGTLLPSGPQR 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 12..140 CDD:459768
GLECT 172..297 CDD:238025
Pex23NP_730508.1 DysFN 64..125 CDD:214777
Tectonin 210..398 CDD:465992
PH-like 639..759 CDD:473070
Gal-bind_lectin 821..953 CDD:459768
TECPR 966..1000 CDD:214782
DysFN 1021..1081 CDD:214777
DysFC 1092..>1113 CDD:128935
Tectonin <1165..1333 CDD:465992
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.