DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and LGALS8

DIOPT Version :9

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_006490.3 Gene:LGALS8 / 3964 HGNCID:6569 Length:359 Species:Homo sapiens


Alignment Length:359 Identity:84/359 - (23%)
Similarity:132/359 - (36%) Gaps:87/359 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FAGNLSHPLEFGHVLEVVAKTIDGAARFHINLCTAKSTVDPNADIGLRFSCYF-RNDVIVRNSRI 68
            |.|.:...|:.|.::.:.......|.||.::|... |::.|.||:...|:..| |...||.|:.|
Human    19 FVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNG-SSMKPRADVAFHFNPRFKRAGCIVCNTLI 82

  Fly    69 NGAWGEEESHVMDPNTLPNPIVSGEFFLVYILCCEDSFAISINSREFCRFRYRMPLGTIRALEIR 133
            |..||.||.      |...|....:.|.:.|:..:|.|.:::|.:....:.:|:....|..|.|.
Human    83 NEKWGREEI------TYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIY 141

  Fly   134 DQIQV--------------------------------------------IKQVDHRTVFPN---- 150
            .::.:                                            |.::..|||:..    
Human   142 GKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLPSNRGGDISKIAPRTVYTKSKDS 206

  Fly   151 ------------PWPAVHASDYFKAFSNDQPILFSPGHVIVLTARCFENKKGQFIIKFMDSDTKR 203
                        |...|.....|.|..|..   ..||..:|:......|.| .|.:..:...:|.
Human   207 TVNHTLTCTKIPPMNYVSKRLPFAARLNTP---MGPGRTVVVKGEVNANAK-SFNVDLLAGKSKD 267

  Fly   204 EELHFSVRFDEKAVVRNSMNKNFEFGSEERH-GGFPFVFNQQFKLALAFTEREVLTAVDGYNFFS 267
            ..||.:.|.:.||.||||..:. .:|.|||: ..|||.....|::.:....||...||:|.:...
Human   268 IALHLNPRLNIKAFVRNSFLQE-SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLE 331

  Fly   268 YTWRTPNAMMNLVGFK-VTSINGLVVQITGVDHL 300
            |..|          || ::||:.|  :|.|..||
Human   332 YKHR----------FKELSSIDTL--EINGDIHL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 5..140 CDD:278752 35/179 (20%)
GLECT 172..297 CDD:238025 37/126 (29%)
LGALS8NP_006490.3 Gal-bind_lectin 18..151 CDD:278752 35/138 (25%)
Gal-bind_lectin 236..356 CDD:214904 40/135 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4988
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.