DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and LGALS4

DIOPT Version :9

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_006140.1 Gene:LGALS4 / 3960 HGNCID:6565 Length:323 Species:Homo sapiens


Alignment Length:283 Identity:74/283 - (26%)
Similarity:111/283 - (39%) Gaps:54/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IDGAA-----RFHINLCTAKSTVDPNADIGLRFSCYFRN-DVIVRNSRINGAWGEEESHVMDPNT 84
            |.|.|     ||.:|....:   ||.:|:...|:..|.. |.:|.|:...|.||.||      ..
Human    35 IQGVASEHMKRFFVNFVVGQ---DPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEE------RK 90

  Fly    85 LPNPIVSGEFF-LVYILCCEDSFAISINSREFCRFRYRMPLGTIRALEIRD--QIQVIKQVDHRT 146
            ...|...|..| ||:|:..| .:.:.:|...|..:.:|:||..:..|::..  |:|.|..:..:.
Human    91 RSMPFKKGAAFELVFIVLAE-HYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQP 154

  Fly   147 VFPN------PWPAV-HASDYFKAF-SNDQPILFSP----------GHVIVLTARCFENKKG--- 190
            :.|.      |:|.. |......:. :.:.|..|:|          |    ||||.....||   
Human   155 LRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGG----LTARRTIIIKGYVP 215

  Fly   191 ----QFIIKFMDSDTKREELHFSVRFDEKAVVRNSMNKNFEFGSEER---HGGFPFVFNQQFKLA 248
                .|.|.|....:....||.:.|.....|||||: .|..:||||:   |.  ||...|.|.|:
Human   216 PTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSL-LNGSWGSEEKKITHN--PFGPGQFFDLS 277

  Fly   249 LAFTEREVLTAVDGYNFFSYTWR 271
            :...........:|.:.|.:..|
Human   278 IRCGLDRFKVYANGQHLFDFAHR 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 5..140 CDD:278752 34/122 (28%)
GLECT 172..297 CDD:238025 34/120 (28%)
LGALS4NP_006140.1 GLECT 18..147 CDD:238025 34/121 (28%)
Gal-bind_lectin 199..322 CDD:214904 32/109 (29%)
Beta-galactoside binding. /evidence=ECO:0000250 256..262 4/5 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.