DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and LGALS3

DIOPT Version :10

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001344607.1 Gene:LGALS3 / 3958 HGNCID:6563 Length:264 Species:Homo sapiens


Alignment Length:118 Identity:32/118 - (27%)
Similarity:51/118 - (43%) Gaps:21/118 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LCTAKSTVDPNA-----------DIGLRFSCYFRND---VIVRNSRINGAWGEEESHVMDPNTLP 86
            |.|...||.|||           |:...|:..|..:   |||.|::::..||.||...:      
Human   145 LITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSV------ 203

  Fly    87 NPIVSGEFFLVYILCCEDSFAISINSREFCRFRYRM-PLGTIRALEIRDQIQV 138
            .|..||:.|.:.:|...|.|.:::|.....::.:|: .|..|..|.|...|.:
Human   204 FPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 12..140 CDD:459768 32/118 (27%)
GLECT 172..297 CDD:238025
LGALS3NP_001344607.1 PRK07764 <23..127 CDD:236090
GLECT 131..258 CDD:238025 32/118 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.