DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and LGALS2

DIOPT Version :10

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_006489.1 Gene:LGALS2 / 3957 HGNCID:6562 Length:132 Species:Homo sapiens


Alignment Length:125 Identity:29/125 - (23%)
Similarity:52/125 - (41%) Gaps:22/125 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 PGHVIVLTARCFENKKGQFIIKFMDSDTKREELHFSVRFDEKAVVRNSMNKNFEFGSEERHGGFP 238
            ||..:.:|....:...| |:|. :...|.:..|||:.||.|..:|.||::.: .:|.|:|.....
Human    14 PGSTLKITGSIADGTDG-FVIN-LGQGTDKLNLHFNPRFSESTIVCNSLDGS-NWGQEQREDHLC 75

  Fly   239 FVFNQQFKLALAF-TEREVLTAVDGYNFFSYTWRTPNAM-------------MNLVGFKV 284
            |....:.|..:.| :::..:...||:..     ..||.:             .|:..||:
Human    76 FSPGSEVKFTVTFESDKFKVKLPDGHEL-----TFPNRLGHSHLSYLSVRGGFNMSSFKL 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 12..140 CDD:459768
GLECT 172..297 CDD:238025 29/125 (23%)
LGALS2NP_006489.1 GLECT 11..129 CDD:238025 27/122 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.