DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and LGALS2

DIOPT Version :9

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_006489.1 Gene:LGALS2 / 3957 HGNCID:6562 Length:132 Species:Homo sapiens


Alignment Length:125 Identity:29/125 - (23%)
Similarity:52/125 - (41%) Gaps:22/125 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 PGHVIVLTARCFENKKGQFIIKFMDSDTKREELHFSVRFDEKAVVRNSMNKNFEFGSEERHGGFP 238
            ||..:.:|....:...| |:|. :...|.:..|||:.||.|..:|.||::.: .:|.|:|.....
Human    14 PGSTLKITGSIADGTDG-FVIN-LGQGTDKLNLHFNPRFSESTIVCNSLDGS-NWGQEQREDHLC 75

  Fly   239 FVFNQQFKLALAF-TEREVLTAVDGYNFFSYTWRTPNAM-------------MNLVGFKV 284
            |....:.|..:.| :::..:...||:..     ..||.:             .|:..||:
Human    76 FSPGSEVKFTVTFESDKFKVKLPDGHEL-----TFPNRLGHSHLSYLSVRGGFNMSSFKL 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 5..140 CDD:278752
GLECT 172..297 CDD:238025 29/125 (23%)
LGALS2NP_006489.1 GLECT 11..129 CDD:238025 27/122 (22%)
Beta-galactoside binding. /evidence=ECO:0000255 65..71 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.