DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and galectin

DIOPT Version :9

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster


Alignment Length:319 Identity:73/319 - (22%)
Similarity:116/319 - (36%) Gaps:98/319 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EFGHVLEVVAKTIDG-----AARFHINLCTAKSTVDPNADIGLRFSCYFRNDVIVRNSRINGAWG 73
            :.|.:.|.::.|:.|     ..||.|||...    :.:.|:.|..:.....:.||||:::...||
  Fly   142 QIGKLSEGISFTVTGNLSVNCERFSINLVYN----NDSRDVALHINPRLPQNYIVRNTKVQDIWG 202

  Fly    74 EEESHVMDPNTLPNPIVSGEFFLVYILCCEDSFAISINSREFCRFRYRMPLGTIRALEIRDQIQ- 137
            .||.    .:.||..:..||.|.:.:|..|..:.||:|.:.|..:.:|:|...:|.||::..:. 
  Fly   203 NEEV----SSALPFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYTHRIPYRDVRILEVKGDVSN 263

  Fly   138 -------VIK--------------------------QVDHRTVFPNPWPAVHA----SD------ 159
                   |:|                          .|:.....|:.|..:.|    ||      
  Fly   264 VEMKRTLVLKYPERLPQSEANNIELHIDDGINEIDASVEETVKIPHEWCIISAPNTQSDSSPKRN 328

  Fly   160 -----------YFKAFSN----DQPILFSPGHVIVLTARCFEN-KKGQFI-----IKFMDSDTKR 203
                       |:.|...    |...|...|.|.:|....:.| ::||.|     |.|       
  Fly   329 NSSNDLGLTLPYYGALPPNSLVDGRCLKIEGRVRLLPHSFYINLQQGQDIWPHPVIAF------- 386

  Fly   204 EELHFSVRFDE-------KAVVRNSMNKNFEFGSEERHGGFPFVF--NQQFKLALAFTE 253
               |.:.||.:       ||||..:...|..:..||| ..|...|  .:.|.||:..|:
  Fly   387 ---HLNPRFSKASSGAIGKAVVCRNAWLNGAWAQEER-SEFDTNFRPGRSFCLAIVCTK 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 5..140 CDD:278752 36/138 (26%)
GLECT 172..297 CDD:238025 26/97 (27%)
galectinNP_608487.1 GLECT 143..262 CDD:238025 35/126 (28%)
Gal-bind_lectin 339..479 CDD:278752 30/114 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 1 1.000 - - otm14067
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11346
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4988
SonicParanoid 1 1.000 - - X133
87.950

Return to query results.
Submit another query.