DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and LOC3291282

DIOPT Version :10

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_061514010.1 Gene:LOC3291282 / 3291282 VectorBaseID:AGAMI1_011527 Length:397 Species:Anopheles gambiae


Alignment Length:128 Identity:30/128 - (23%)
Similarity:56/128 - (43%) Gaps:10/128 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FAGNLSHPLEFGHVLEVVAKTIDGAARFHINLCTAKSTVDPNADIGLRFSCYFRNDVIVRNSRIN 69
            :.|.|...|.:|..:::.....:.....|| :...::.::|..::.|..:.:.....||||...:
Mosquito    70 YVGRLPGELRYGSRIKLRGHFREPEDAVHI-ILQREALLNPQDELPLYLTIHPGRKEIVRNHLCS 133

  Fly    70 G-AWGEEESHVMDPNTLPN-PIVSGEFFLVYILCCEDSFAISINSREFCRFRYRMPLGTIRAL 130
            . :.|.||       .:.| ||..|:.|.:.|:...:.:.:|::......|.||.||.|.|.|
Mosquito   134 DCSAGPEE-------RIDNCPIECGQDFELAIVPSANGYELSLHGTPAHTFSYRAPLATARYL 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 12..140 CDD:459768 28/121 (23%)
GLECT 172..297 CDD:238025
LOC3291282XP_061514010.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.