DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and Lgals7

DIOPT Version :10

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_072104.2 Gene:Lgals7 / 29518 RGDID:61951 Length:136 Species:Rattus norvegicus


Alignment Length:130 Identity:37/130 - (28%)
Similarity:58/130 - (44%) Gaps:9/130 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSHPLEFGHVLEVVAKTIDGAARFHINLCTAKSTVDPNADIGLRFSCYFRNDVIVRNSRINGAWG 73
            |...:..|.|:.:.....|.|.|||:||...:   :..||..|.|:.......:|.|::..|.||
  Rat    10 LPQGVRLGTVMRIRGVVPDQAGRFHVNLLCGE---EQEADAALHFNPRLDTSEVVFNTKQQGKWG 71

  Fly    74 EEESHVMDPNTLPNPIVSGEFFLVYILCCEDSFAISINSREFCRFRYRMPLGTIRALEIRDQIQV 138
            .||      .....|...|:.|.|.|:..|:.|...|...|:..|.:|||...:|::|:...:|:
  Rat    72 REE------RGTGIPFQRGQPFEVLIITTEEGFKTVIGDDEYLHFHHRMPSSNVRSVEVGGDVQL 130

  Fly   139  138
              Rat   131  130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 12..140 CDD:459768 36/127 (28%)
GLECT 172..297 CDD:238025
Lgals7NP_072104.2 GLECT 5..134 CDD:238025 37/130 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.