DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and Lgals12

DIOPT Version :9

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001099803.1 Gene:Lgals12 / 293710 RGDID:1306914 Length:314 Species:Rattus norvegicus


Alignment Length:308 Identity:68/308 - (22%)
Similarity:113/308 - (36%) Gaps:85/308 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 AARFHINL-CTAKSTVDPNADIGLRFS--CYFRNDVIVRNSRINGAWGEEESHVMDPNTLPNPIV 90
            |.||.::. |..  .:.|..|:...||  .|.....::.|:...|.|.:|   |..|..   .:.
  Rat    51 ARRFQVDFQCGC--CLHPRPDVAFHFSPRFYTVKPHVICNTLQGGLWQKE---VRWPGI---ALQ 107

  Fly    91 SGEFFLVYILCCEDSFAISINSREFCRFRYRMPLGTIRALEIRDQIQVIKQVDHRTVFPNPWPAV 155
            .|..||:..|...:...:|:|.:.|..:|||:||..:..|:|...| ::|.|....:.|      
  Rat   108 KGASFLILFLFDNEEVKVSVNGQHFLHYRYRLPLSRVDTLDISGDI-LVKAVGFLNISP------ 165

  Fly   156 HASDYFKAFSNDQPI-----LFS----------------PGHVIVLTARCFENKKGQFIIKFMDS 199
                 |...|.:.|:     |:|                ||.|||:.....:..| .|.:...|.
  Rat   166 -----FVEGSREYPVGYPLLLYSPRLEVPCSRALPRGLWPGQVIVVRGLVLKEPK-DFTLSLRDG 224

  Fly   200 DTKREELHFSV----RFDEKAVVRNSMNKNFEFGSEERHGGFPFVFNQQ--FKLALAFTEREVLT 258
            .|     |..|    .|.::.:...|     .:|.::.... ||:|..|  |::.|...|..:..
  Rat   225 AT-----HVPVTLRASFTDRTLAWVS-----SWGRKKLISA-PFLFYPQRFFEVLLLCQEGGLKL 278

  Fly   259 AVDGYNFFSYTWRTPNAMMNLVGFKVTSINGLVVQ------ITGVDHL 300
            |::|:                 |...||::...::      |:|..||
  Rat   279 ALNGH-----------------GLGATSLDQKALEQLRDLRISGSVHL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 5..140 CDD:278752 30/113 (27%)
GLECT 172..297 CDD:238025 28/152 (18%)
Lgals12NP_001099803.1 Gal-bind_lectin 26..160 CDD:395266 32/117 (27%)
Gal-bind_lectin 195..313 CDD:214904 30/144 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.