DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and Lgals5

DIOPT Version :9

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_037108.1 Gene:Lgals5 / 25475 RGDID:3004 Length:145 Species:Rattus norvegicus


Alignment Length:117 Identity:38/117 - (32%)
Similarity:57/117 - (48%) Gaps:18/117 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IDGAARFHINL-CTAKSTVDPNADIGLRFSCYFRNDVIVRNSRINGAWGEEESHVMDPNTLPN-- 87
            :..|.||.||| |        ..||....:..|..:.:|||::||.:||.||      .:||.  
  Rat    38 LSDAKRFQINLRC--------GGDIAFHLNPRFDENAVVRNTQINNSWGPEE------RSLPGSM 88

  Fly    88 PIVSGEFFLVYILCCEDSFAISINSREFCRFRYR-MPLGTIRALEIRDQIQV 138
            |...|:.|.|:|||....|.::::.:..|.:.:| |.|..|..||:...||:
  Rat    89 PFSRGQRFSVWILCEGHCFKVAVDGQHICEYSHRLMNLPDINTLEVAGDIQL 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 5..140 CDD:278752 38/117 (32%)
GLECT 172..297 CDD:238025
Lgals5NP_037108.1 Gal-bind_lectin 22..144 CDD:214904 38/117 (32%)
Beta-galactoside binding. /evidence=ECO:0000255 77..83 4/11 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.