DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and Lgals4

DIOPT Version :9

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_008757335.1 Gene:Lgals4 / 25474 RGDID:3003 Length:349 Species:Rattus norvegicus


Alignment Length:259 Identity:67/259 - (25%)
Similarity:108/259 - (41%) Gaps:42/259 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LEVVAKTIDGAARFHINLCTAKSTVDPNADIGLRFSCYFRN-DVIVRNSRINGAWGEEESHVMDP 82
            ::.:||  |...|||:|....:   |..|||...|:..|.. |.:|.|:..:|.||:||      
  Rat    35 IQGIAK--DNMRRFHVNFAVGQ---DEGADIAFHFNPRFDGWDKVVFNTMQSGQWGKEE------ 88

  Fly    83 NTLPNPIVSGEFFLVYILCCEDSFAISINSREFCRFRYRMPLGTIRALEIRDQIQVIKQVDH--- 144
            .....|...|..|.:..:...:.:.:.:|...|..:.:|:||..:..|::...:: ::.::.   
  Rat    89 KKKSMPFQKGHHFELVFMVMSEHYKVVVNGTPFYEYGHRLPLQMVTHLQVDGDLE-LQSINFLGG 152

  Fly   145 ---RTVFPNPW--PAVHASDYFKAFSNDQPI-----LFSPGHVIV------LTARCFENKKG--- 190
               .:.:|...  ||..::.|.....|..|:     :|:|....|      ||||.....||   
  Rat   153 QPAASQYPGTMTIPAYPSAGYNPPQMNSLPVMAGPPIFNPPVPYVGTLQGGLTARRTIIIKGYVL 217

  Fly   191 ----QFIIKFMDSDTKREELHFSVRFDEKAVVRNSMNKNFEFGSEERHGGF-PFVFNQQFKLAL 249
                ..||.|....|.....|.:.|..: .|||||. .|..:|||||...: ||...|.|.::|
  Rat   218 PTAKNLIINFKVGSTGDIAFHMNPRIGD-CVVRNSY-MNGSWGSEERKIPYNPFGAGQFFDVSL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 5..140 CDD:278752 30/121 (25%)
GLECT 172..297 CDD:238025 31/92 (34%)
Lgals4XP_008757335.1 Gal-bind_lectin 24..148 CDD:214904 30/124 (24%)
Gal-bind_lectin 201..348 CDD:214904 28/81 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.