DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and F47G9.6

DIOPT Version :9

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001335507.1 Gene:F47G9.6 / 185950 WormBaseID:WBGene00009833 Length:339 Species:Caenorhabditis elegans


Alignment Length:257 Identity:47/257 - (18%)
Similarity:78/257 - (30%) Gaps:87/257 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FGHVLEVVAKTID--GAARFHINLCTAKSTVDPNADIGLRFSCYFRNDVIVRNSRINGAWGEEES 77
            |...:..|...||  |.::|.|:..:....|..        |.|...:.:|...:.|..:.||::
 Worm    90 FPQKVRAVYHVIDREGRSKFEISPASTDKLVAK--------SGYLSTEWMVGLHKYNEYFSEEDN 146

  Fly    78 HVMDPNTLPNPIVSGEFFLVYILCCEDSFAISINSREFCRFRY---------RMPLGTIRALEIR 133
            .....|         .:|......|:....:||:.:......|         .:|:.::...|:.
 Worm   147 LFAYTN---------NYFPAQYYGCQYRDHMSIHYKFVRTLGYAFEPISIPTNLPIYSLIETEVE 202

  Fly   134 DQIQVIKQVDHRTVFPNPWPAVHASDYFKAFSNDQPI-LFSPGHVIVLTARCFENKKGQFIIKFM 197
            |.:..          |:|        |...:....|| ||.|...                    
 Worm   203 DDVTT----------PSP--------YVPKYIKSAPIDLFRPAGT-------------------- 229

  Fly   198 DSDTKREELHFSVRFDEK------AVVRNSMNKNFEFGSE------ERHGGFPFVF---NQQ 244
                 |.:..|||..|.|      :|.|.:..|...|.|:      |:.|....:|   ||:
 Worm   230 -----RPQTKFSVGGDLKIVPQSQSVARVNQTKACAFSSQIVLQELEKCGKITTIFQWVNQE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 5..140 CDD:278752 23/135 (17%)
GLECT 172..297 CDD:238025 18/88 (20%)
F47G9.6NP_001335507.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.