DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and F46A8.5

DIOPT Version :9

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_492883.1 Gene:F46A8.5 / 185821 WormBaseID:WBGene00009748 Length:218 Species:Caenorhabditis elegans


Alignment Length:67 Identity:18/67 - (26%)
Similarity:31/67 - (46%) Gaps:1/67 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 FSVRFDEKAVVRNSMNKNFEFGSEERHGGFPFVFNQQFKLALAFTEREVLTAVDGYNFFSYTWRT 272
            |:.:.|...||| :.::|.:|...:.:||.||.....|.:.:......:...|:...|.:|..||
 Worm   130 FASQPDLGRVVR-TRHQNGQFLQGDTYGGNPFPAGANFNVTMINQPSAIEIHVNQVFFTNYNHRT 193

  Fly   273 PN 274
            .|
 Worm   194 GN 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 5..140 CDD:278752
GLECT 172..297 CDD:238025 18/67 (27%)
F46A8.5NP_492883.1 GLECT 91..217 CDD:214596 18/67 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.