DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and F40H6.5

DIOPT Version :9

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001367438.1 Gene:F40H6.5 / 185576 WormBaseID:WBGene00018255 Length:1229 Species:Caenorhabditis elegans


Alignment Length:129 Identity:30/129 - (23%)
Similarity:47/129 - (36%) Gaps:22/129 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EFAGNLS-HPLEFGHVLEV---VAKT-------IDGAARFHINLCTAKSTVDPNADIGLRFSCYF 57
            :|.|||. .|:.|...:||   :..|       .:....|::.......|......|..|:|...
 Worm   917 QFYGNLLWRPVVFSRYMEVGDNITLTGFIWNNATESNVNFYLGFNPLFGTTAVPVHISQRWSSSA 981

  Fly    58 RNDVIVRNSRINGAWGEEESHVMDPNTLPNPIVSGEFFLVYILCCEDSFAISINSREFCRFRYR 121
            |   |:.|: ..|.||.|....       .|...|:.|::.::...:|..|..|.:....|.||
 Worm   982 R---IIYNN-FWGQWGPEAFSA-------RPFTRGQPFVISLIKTANSHQIYGNGQLLINFGYR 1034

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 5..140 CDD:278752 30/128 (23%)
GLECT 172..297 CDD:238025
F40H6.5NP_001367438.1 GLECT 686..811 CDD:238025
Gal-bind_lectin 930..1034 CDD:214904 22/114 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.