Sequence 1: | NP_611349.2 | Gene: | CG5335 / 37140 | FlyBaseID: | FBgn0034365 | Length: | 321 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001263496.1 | Gene: | C27C7.5 / 182958 | WormBaseID: | WBGene00007768 | Length: | 279 | Species: | Caenorhabditis elegans |
Alignment Length: | 195 | Identity: | 42/195 - (21%) |
---|---|---|---|
Similarity: | 74/195 - (37%) | Gaps: | 53/195 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 124 LGTIRALEIRDQIQVIKQVDHRTV-----------FPNP----WPAVHASDYFKAFSND------ 167
Fly 168 --------------QPILFSPGHVIVLTARCFENKKGQFIIKF---------MDSDTKREELHFS 209
Fly 210 VRFDEKAVVRNSMNKNFEFGSEERHGGFPFVFNQQFKLALAFTEREVLTAVDGYNFFSYTWRTPN 274
Fly 275 274 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5335 | NP_611349.2 | Gal-bind_lectin | 5..140 | CDD:278752 | 3/15 (20%) |
GLECT | 172..297 | CDD:238025 | 30/112 (27%) | ||
C27C7.5 | NP_001263496.1 | CW | 17..109 | CDD:214742 | 6/37 (16%) |
Gal-bind_lectin | 149..271 | CDD:278752 | 31/117 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D357844at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11346 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.020 |