DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and C27C7.5

DIOPT Version :9

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001263496.1 Gene:C27C7.5 / 182958 WormBaseID:WBGene00007768 Length:279 Species:Caenorhabditis elegans


Alignment Length:195 Identity:42/195 - (21%)
Similarity:74/195 - (37%) Gaps:53/195 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 LGTIRALEIRDQIQVIKQVDHRTV-----------FPNP----WPAVHASDYFKAFSND------ 167
            :.|:..|:..:.::|..::::.|.           ||:.    |.....|:|...|:.|      
 Worm    71 VSTVEKLDPEENLKVAMKINNSTADTTCPTSISGSFPSKMRSMWETFTNSNYNITFTGDLWKFSY 135

  Fly   168 --------------QPILFSPGHVIVLTARCFENKKGQFIIKF---------MDSDTKREELHFS 209
                          ..|:|..||        |:.|:...:|.:         ::|.......||:
 Worm   136 QDKVTQAGSNYALPYTIIFPDGH--------FKLKQSIVLIGYPSEQRWFLNIESSIGEVLFHFN 192

  Fly   210 VRFDEKAVVRNSMNKNFEFGSEERHGGFPFVFNQQFKLALAFTEREVLTAVDGYNFFSYTWRTPN 274
            .|.:...||| |.::|..:...|..||:||...|||.|.:..:..::...::...|..|..||||
 Worm   193 PRPEVNEVVR-STHRNGVWEMYESSGGYPFTAGQQFNLTITNSISDLQMYINQVWFADYRHRTPN 256

  Fly   275  274
             Worm   257  256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 5..140 CDD:278752 3/15 (20%)
GLECT 172..297 CDD:238025 30/112 (27%)
C27C7.5NP_001263496.1 CW 17..109 CDD:214742 6/37 (16%)
Gal-bind_lectin 149..271 CDD:278752 31/117 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.