DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and C09F9.1

DIOPT Version :10

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_497052.1 Gene:C09F9.1 / 182455 WormBaseID:WBGene00007478 Length:131 Species:Caenorhabditis elegans


Alignment Length:107 Identity:22/107 - (20%)
Similarity:41/107 - (38%) Gaps:27/107 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSHPLEFGHVLEVVAKTIDGAARFHINLCTAKSTVDPNADIGLRFSCYFRNDVIVRNSRINGAWG 73
            |:.||:  |:.:|..:...||:......|. :|.::         |.|  :|::...:|.|..  
 Worm    40 LAPPLK--HIPKVEKEEDSGASVMETKRCD-QSNME---------SAY--HDIVSIKNRPNSC-- 88

  Fly    74 EEESHVMDPNTLPNPIVSGEFFLVYILCCEDSFAISINSREF 115
             :..||          .|..|.:|.::.......:|.|:..|
 Worm    89 -DTCHV----------ASLVFLIVLVIAISTPVLLSANNGGF 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 12..140 CDD:459768 21/104 (20%)
GLECT 172..297 CDD:238025
C09F9.1NP_497052.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.