DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and lec-8

DIOPT Version :10

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_509649.1 Gene:lec-8 / 181198 WormBaseID:WBGene00002271 Length:180 Species:Caenorhabditis elegans


Alignment Length:118 Identity:29/118 - (24%)
Similarity:49/118 - (41%) Gaps:19/118 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GHVLEVVAKTIDGAARFHINLCTAKSTVDPNADIGLRFSCYFRNDVIVRNSRINGAWGEEESHVM 80
            |||.....|.      |.:.|.:....|   ..:..||.   .:.::..|:..|||||.|..|  
 Worm    29 GHVTHKHHKD------FSVELLSGPHIV---LHVNFRFE---HDHIVAMNTCTNGAWGAEIRH-- 79

  Fly    81 DPNTLPNPIVSGEFFLVYILCCEDSFAISINSREFCRFRYRMPLGTIRALEIR 133
                 .||:...:.|.:.|...|..:.||:|......|.:|.|:.:::|:.::
 Worm    80 -----HNPLKHHDHFNLSIHVHEGYYHISVNGEHLADFPHRFPVESVQAIGLK 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 12..140 CDD:459768 29/118 (25%)
GLECT 172..297 CDD:238025
lec-8NP_509649.1 GLECT 14..138 CDD:214596 29/118 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.