DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and pqn-84

DIOPT Version :10

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_499514.3 Gene:pqn-84 / 176601 WormBaseID:WBGene00004165 Length:392 Species:Caenorhabditis elegans


Alignment Length:111 Identity:22/111 - (19%)
Similarity:50/111 - (45%) Gaps:8/111 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LEFGHVLEVVAKTIDGAARFHINLCTAKSTVDPNADIGLRFSCYFRNDVIVRNSRINGAWGEEES 77
            :|.|..|.:..|.::.|...:::|....::|...:.:.|.....:..:.|:.||.. |:||.|:.
 Worm    43 MEVGDKLTMKGKIMNPANMSYLHLYQGFNSVYEKSPLSLHIRVQYLRNSIIYNSWF-GSWGGEQF 106

  Fly    78 HVMDPNTLPNPIVSGEFFLVYILCCEDSFAISINSREFCRFRYRMP 123
            .       ..|.:||.::.:.:|.....::|.:.:....::.:|.|
 Worm   107 S-------QQPFLSGNYYSISVLKGPTYYSIYMGNLLITKYAFRNP 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 12..140 CDD:459768 22/111 (20%)
GLECT 172..297 CDD:238025
pqn-84NP_499514.3 Gal-bind_lectin 41..165 CDD:459768 22/111 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.