DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and lec-2

DIOPT Version :9

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001379091.1 Gene:lec-2 / 174560 WormBaseID:WBGene00002265 Length:1245 Species:Caenorhabditis elegans


Alignment Length:313 Identity:85/313 - (27%)
Similarity:129/313 - (41%) Gaps:68/313 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FAGNLSHPLEFGHVLEVVAKTIDGAARFHINLCTAKSTVDPNADIGLRFSCYFRNDVIVRNSRIN 69
            :...|..|.|.|..|.|..||.:.:.||.:||.|..:....| |:.|..|..|....:|.|:...
 Worm   978 YRSKLVEPFEPGQTLIVKGKTGEDSIRFTVNLHTNTADFSGN-DVPLHVSVRFDEGKLVFNTFSK 1041

  Fly    70 GAWGEEESHVMDPNTLPNPIVSGEFFLVYILCCEDSFAISINSREFCRFRYRMPLGTIRALEIRD 134
            |.||:||..       .||...|:...:.|...:..|.|.::.:|...:.:|:||.:|....|..
 Worm  1042 GEWGKEERK-------SNPYKKGDDIDIRIRAHDSKFQIFVDQKEVKEYEHRVPLSSITHFTIDG 1099

  Fly   135 QIQVIKQVDHRTVFPNPWPAVHASDYFKAFSNDQPILFSPGHVIVLTARCF---ENKKGQFIIKF 196
            .:.|.........:|.|:.:..|.:.           .:||..:.:    |   |.|..:|.|..
 Worm  1100 DVLVNYIHWGGKYYPVPYESGLAGEG-----------LAPGKTLTV----FGIPEKKAKRFHINL 1149

  Fly   197 MDSDTKRE---ELHFSVRFDEKAVVRNSMNKNFEFGSEERHGGFPF---------VFNQQFKLAL 249
            :    |:.   .||.:.|||||.|||||: .|..:|:|||.|..||         :.|:.:..|:
 Worm  1150 L----KKNGDIALHLNARFDEKHVVRNSL-INSAWGNEEREGKMPFEKAVGFDLEIHNEPYAFAV 1209

  Fly   250 AFTEREVLTAVDGYNFFSYTWR-TPNAMMNLVGFKVTSINGLV----VQITGV 297
                     .|:|..|.||..| :|:           .:|||.    |:|||:
 Worm  1210 ---------TVNGERFASYAHRLSPD-----------EVNGLQIGGDVEITGI 1242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 5..140 CDD:278752 38/134 (28%)
GLECT 172..297 CDD:238025 43/144 (30%)
lec-2NP_001379091.1 rne <136..298 CDD:236766
PRK14949 <235..662 CDD:237863
rne <474..771 CDD:236766
rne <794..963 CDD:236766
GLECT 978..1108 CDD:214596 38/137 (28%)
GLECT 1116..1243 CDD:238025 46/167 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I6518
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 1 1.000 - - otm14067
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.