DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and F46A8.3

DIOPT Version :10

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_492885.1 Gene:F46A8.3 / 173018 WormBaseID:WBGene00009746 Length:228 Species:Caenorhabditis elegans


Alignment Length:110 Identity:28/110 - (25%)
Similarity:45/110 - (40%) Gaps:19/110 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GHVLEVVAKTIDGAARFHINLCTAKSTVDPNADIGLRFSCYFRNDVIVRNSRINGAW--GEEESH 78
            |.::.:..  |.|:.|:.|||..:::.|       ..|:|.....::.|....||||  ||..|.
 Worm   113 GKIMRIYG--IPGSGRWTINLAKSQTWV-------FHFACEPTKGLVARTRHTNGAWEVGETYSE 168

  Fly    79 VMDPNTLPNPIVSGEFFLVYILCCEDSFAISINSREFCRFRYRMP 123
                    ||..:...|.|.::.......|.:|...|..|.:|:|
 Worm   169 --------NPFQANTQFNVTMVNQPTHIEIHVNGAFFVNFNHRVP 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 12..140 CDD:459768 28/110 (25%)
GLECT 172..297 CDD:238025
F46A8.3NP_492885.1 GLECT 102..227 CDD:214596 28/110 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.