DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and Lgals2

DIOPT Version :10

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_038934274.1 Gene:Lgals2 / 171134 RGDID:621269 Length:168 Species:Rattus norvegicus


Alignment Length:73 Identity:22/73 - (30%)
Similarity:34/73 - (46%) Gaps:10/73 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NLSHPLEFGHVLEVVAKTIDGAARFHINLCTAKSTVDPNADIGLRFSCYFRNDVIVRNSRINGAW 72
            ||:  ::.|..|::..|..:....|.|||...|.|      :.|.|:..|....||.|:....:|
  Rat     9 NLN--MKSGMSLKIKGKIHNDVNSFTINLGQGKET------LNLHFNPRFNESTIVCNTLDGSSW 65

  Fly    73 GEE--ESH 78
            |:|  |:|
  Rat    66 GQEQRENH 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 12..140 CDD:459768 20/69 (29%)
GLECT 172..297 CDD:238025
Lgals2XP_038934274.1 GLECT 5..168 CDD:214596 22/73 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.