DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and Lgals7

DIOPT Version :9

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_032522.2 Gene:Lgals7 / 16858 MGIID:1316742 Length:136 Species:Mus musculus


Alignment Length:136 Identity:36/136 - (26%)
Similarity:60/136 - (44%) Gaps:9/136 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TEFAGNLSHPLEFGHVLEVVAKTIDGAARFHINLCTAKSTVDPNADIGLRFSCYFRNDVIVRNSR 67
            |:...:|...:..|.|:.:.....|.|.|||:||...:   :..||..|.|:.......:|.|::
Mouse     4 TQHKTSLPQGVRVGTVMRIRGMVPDQAGRFHVNLLCGE---EQGADAALHFNPRLDTSEVVFNTK 65

  Fly    68 INGAWGEEESHVMDPNTLPNPIVSGEFFLVYILCCEDSFAISINSREFCRFRYRMPLGTIRALEI 132
            ..|.||.||      .....|...|:.|.|.::..|:.|...:...|:..|.:|||...:|.:|:
Mouse    66 EQGKWGREE------RGTGIPFERGQPFEVLLIATEEGFKAVVGDDEYLHFHHRMPPARVRLVEV 124

  Fly   133 RDQIQV 138
            ...:|:
Mouse   125 GGDVQL 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 5..140 CDD:278752 35/134 (26%)
GLECT 172..297 CDD:238025
Lgals7NP_032522.2 Gal-bind_lectin 5..133 CDD:366037 35/135 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.