DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and Lgals4

DIOPT Version :9

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_034836.1 Gene:Lgals4 / 16855 MGIID:107536 Length:326 Species:Mus musculus


Alignment Length:297 Identity:64/297 - (21%)
Similarity:115/297 - (38%) Gaps:58/297 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LEFGHVLEVVAKTIDGAARFHINLCTAKSTVDPNADIGLRFSCYFRN-DVIVRNSRINGAWGEEE 76
            |..|..:.:.....:...|||:|....:   |..||:...|:..|.. |.:|.|:..:|.||:||
Mouse    27 LSVGMSVYIQGMAKENMRRFHVNFAVGQ---DDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEE 88

  Fly    77 SHVMDPNTLPNPIVSGEFFLVYILCCEDSFAISINSREFCRFRYRMPLGTIRALEIRDQIQVIKQ 141
                  .....|...|:.|.:..:...:.:.:.:|...|..:.:|:|:..:..|::...:: ::.
Mouse    89 ------KKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLE-LQS 146

  Fly   142 VDHRTVFP--NPWPAVHASDYFKAFS--------NDQPILFSP---------------------- 174
            ::.....|  .|:|.......:.|.|        |..|::..|                      
Mouse   147 INFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRT 211

  Fly   175 ----GHVIVLTARCFENKKGQFIIKFMDSDTKREELHFSVRFDEKAVVRNSMNKNFEFGSEERHG 235
                |:|:. |||       .|:|.|....:....||.:.|..: :|||||. .|..:|:|||..
Mouse   212 IIIKGYVLP-TAR-------NFVINFKVGSSGDIALHLNPRIGD-SVVRNSF-MNGSWGAEERKV 266

  Fly   236 GF-PFVFNQQFKLALAFTEREVLTAVDGYNFFSYTWR 271
            .: ||...|.|.|::...........:|.:.|.::.|
Mouse   267 AYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHR 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 5..140 CDD:278752 27/127 (21%)
GLECT 172..297 CDD:238025 30/127 (24%)
Lgals4NP_034836.1 GLECT 18..147 CDD:238025 27/129 (21%)
Gal-bind_lectin 203..325 CDD:214904 29/111 (26%)
Beta-galactoside binding. /evidence=ECO:0000250 259..265 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.