DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and Lgals3

DIOPT Version :10

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_034835.1 Gene:Lgals3 / 16854 MGIID:96778 Length:264 Species:Mus musculus


Alignment Length:127 Identity:34/127 - (26%)
Similarity:53/127 - (41%) Gaps:22/127 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LCTAKSTVDPNA-----------DIGLRFSCYFRND---VIVRNSRINGAWGEEESHVMDPNTLP 86
            |.|...||.|||           |:...|:..|..:   |||.|::.:..||:||      ....
Mouse   145 LITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEE------RQSA 203

  Fly    87 NPIVSGEFFLVYILCCEDSFAISINSREFCRFRYRMP-LGTIRALEIRDQIQVIKQVDHRTV 147
            .|..||:.|.:.:|...|.|.:::|.....::.:||. |..|..|.|...| .:...:|..:
Mouse   204 FPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDI-TLTSANHAMI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 12..140 CDD:459768 33/118 (28%)
GLECT 172..297 CDD:238025
Lgals3NP_034835.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..105
PRK07764 <9..139 CDD:236090
9 X 9 AA tandem repeats of Y-P-G-X(3)-P-[GS]-A 35..114
Gal-bind_lectin 137..258 CDD:214904 33/119 (28%)
Nuclear export signal 240..255 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.