DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and Lgals1

DIOPT Version :10

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_032521.1 Gene:Lgals1 / 16852 MGIID:96777 Length:135 Species:Mus musculus


Alignment Length:121 Identity:27/121 - (22%)
Similarity:54/121 - (44%) Gaps:14/121 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 PGHVIVLTARCFENKKGQFIIKFMDSDTKREELHFSVRF----DEKAVVRNSMNKNFEFGSEERH 234
            ||..:.:......:.| .|::. :..|:....|||:.||    |...:|.|: .::..:|:|.|.
Mouse    14 PGECLKVRGEVASDAK-SFVLN-LGKDSNNLCLHFNPRFNAHGDANTIVCNT-KEDGTWGTEHRE 75

  Fly   235 GGFPFVFNQQFKLALAFTEREV-LTAVDGYNFFSYTWRTPNAMMNLVGFKVTSING 289
            ..|||......::.:.|.:.:: :...||:.|     :.|| .:|:......:.:|
Mouse    76 PAFPFQPGSITEVCITFDQADLTIKLPDGHEF-----KFPN-RLNMEAINYMAADG 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 12..140 CDD:459768
GLECT 172..297 CDD:238025 27/121 (22%)
Lgals1NP_032521.1 GLECT 11..135 CDD:214596 27/121 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.