DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and M6.11

DIOPT Version :10

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001256974.1 Gene:M6.11 / 13219106 WormBaseID:WBGene00206478 Length:139 Species:Caenorhabditis elegans


Alignment Length:52 Identity:11/52 - (21%)
Similarity:23/52 - (44%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 NPIVSGEFFLVYILCCEDSFAISINSREFCRFRYRMPLGTIRALEIRDQIQV 138
            |||...:.|.:.|:...|.|.:..........:|.:||..|..:.:.:.:::
 Worm    78 NPIQQNDTFFIQIITTNDHFEVFSGGTFIFSLKYTVPLEKITGIRLMESMEM 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 12..140 CDD:459768 11/52 (21%)
GLECT 172..297 CDD:238025
M6.11NP_001256974.1 GLECT 12..123 CDD:469601 11/44 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.