powered by:
Protein Alignment CG5335 and M6.11
DIOPT Version :9
Sequence 1: | NP_611349.2 |
Gene: | CG5335 / 37140 |
FlyBaseID: | FBgn0034365 |
Length: | 321 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001256974.1 |
Gene: | M6.11 / 13219106 |
WormBaseID: | WBGene00206478 |
Length: | 139 |
Species: | Caenorhabditis elegans |
Alignment Length: | 52 |
Identity: | 11/52 - (21%) |
Similarity: | 23/52 - (44%) |
Gaps: | 0/52 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 87 NPIVSGEFFLVYILCCEDSFAISINSREFCRFRYRMPLGTIRALEIRDQIQV 138
|||...:.|.:.|:...|.|.:..........:|.:||..|..:.:.:.:::
Worm 78 NPIQQNDTFFIQIITTNDHFEVFSGGTFIFSLKYTVPLEKITGIRLMESMEM 129
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3587 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11346 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.