DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and LOC1278417

DIOPT Version :10

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_318003.2 Gene:LOC1278417 / 1278417 VectorBaseID:AGAMI1_007204 Length:145 Species:Anopheles gambiae


Alignment Length:104 Identity:32/104 - (30%)
Similarity:50/104 - (48%) Gaps:7/104 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 AARFHINLCTAKSTVDPNADIGLRFSCYFRNDVIVRNSRINGAWGEEESHVMDPNTLPNPIVSGE 93
            |.||:|||..... |||..|..|..|....:..||||:.::..|.:||      .:...||.:||
Mosquito    36 ADRFNINLQYGPE-VDPRDDTALHLSIRPGDRRIVRNTYVDQCWQDEE------RSGGCPISTGE 93

  Fly    94 FFLVYILCCEDSFAISINSREFCRFRYRMPLGTIRALEI 132
            .|.:.|...:..::|..|..::|.|.:|||...:..:.:
Mosquito    94 PFTLEIRVKDTHYSIRFNDEKYCTFSHRMPFEMVNFIHL 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 12..140 CDD:459768 32/104 (31%)
GLECT 172..297 CDD:238025
LOC1278417XP_318003.2 Gal-bind_lectin 20..142 CDD:459768 32/104 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.