DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and LOC1270644

DIOPT Version :10

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_061518272.1 Gene:LOC1270644 / 1270644 VectorBaseID:AGAMI1_004918 Length:437 Species:Anopheles gambiae


Alignment Length:163 Identity:45/163 - (27%)
Similarity:65/163 - (39%) Gaps:27/163 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FAGNLSHPLEFGHVLEVVAKTIDGAARFHINLCTAKSTVDPNADIGLRFSCYFRNDVIVRNSRIN 69
            |.|.:...|..|.:|.:.....:...|..|.: .:.:.|:|..|:.|..|.......|||||..|
Mosquito    13 FLGLIPGGLSPGRMLRIKGIITNHGERCQIYI-QSGAAVNPRDDVTLHISIRPHEHAIVRNSIQN 76

  Fly    70 GAWGEEESHVMDPNTLPNPIVSGEFFLVYILCCEDSFAISINSREFCRFRYRMPL---------- 124
            ...|.||.:.      ..||..||.|.:.||.....:.|:||...||.|.:|:||          
Mosquito    77 QVVGPEERYG------GCPIRYGESFDLLILAEATQYKIAINGAHFCTFGHRLPLHRAQYISIAA 135

  Fly   125 -GTIRALEIRDQIQVIKQVDHRTVFP-NPWPAV 155
             |||        ..::.:.|.....| ||:|.:
Mosquito   136 GGTI--------YSILSEADVPGSVPVNPYPPI 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 12..140 CDD:459768 38/138 (28%)
GLECT 172..297 CDD:238025
LOC1270644XP_061518272.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.