DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and Grifin

DIOPT Version :9

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_476535.1 Gene:Grifin / 117130 RGDID:71055 Length:144 Species:Rattus norvegicus


Alignment Length:144 Identity:39/144 - (27%)
Similarity:57/144 - (39%) Gaps:14/144 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLTEFAGNLSHPLEFGHVLEVVAKTIDGAARFHINLCTAKSTVDPNADIGLRFSCYFRNDVIVRN 65
            |..:|....:..|..|..|.|......|..:|.||..|      ...||.......|.:..:|.|
  Rat     1 MALQFEAFCAGGLAPGWSLTVQGHADAGEDKFEINFLT------DAGDIAFHVKPRFSSATVVGN 59

  Fly    66 SRINGAWGEEESHVMDPNTLPNPIVSGEFFLVYILCCEDSFAISINSREFCRFRYR-MPLGTIRA 129
            :...|.||:||...:.|.||      ||.|.|.:....:.|.|....::..:|.:| .||.||..
  Rat    60 AFQGGRWGQEEVSSVFPLTL------GEPFEVEVSADTEHFHIYAQEQKVLQFPHRHRPLATITR 118

  Fly   130 LEIRDQIQVIKQVD 143
            :.:....| :.||:
  Rat   119 VRVLSDHQ-LAQVE 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 5..140 CDD:278752 36/135 (27%)
GLECT 172..297 CDD:238025
GrifinNP_476535.1 GLECT 5..132 CDD:214596 38/140 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.