DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and Lgals8

DIOPT Version :9

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_446314.2 Gene:Lgals8 / 116641 RGDID:621272 Length:316 Species:Rattus norvegicus


Alignment Length:312 Identity:72/312 - (23%)
Similarity:130/312 - (41%) Gaps:49/312 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FAGNLSHPLEFGHVLEVVAKTIDGAARFHINLCTAKSTVDPNADIGLRFSCYF-RNDVIVRNSRI 68
            :...::..|:.|.::.:.......:.||.::.....| :.|.||:...|:..| |::.||.|:..
  Rat    18 YVSTITEQLKPGSLIVIRGHVPKDSERFQVDFQHGNS-LKPRADVAFHFNPRFKRSNCIVCNTLT 81

  Fly    69 NGAWG-EEESHVMDPNTLPNPIVSGEFFLVYILCCEDSFAISINSREFCRFRYRMPLGTIRALEI 132
            |..|| ||.:|.|       |....:.|.:.|:..::.|.:::|.:....:.:|:....|..|.|
  Rat    82 NEKWGWEEITHDM-------PFRKEKSFEIVIMVLKNKFQVAVNGKHILLYAHRINPEKIDTLGI 139

  Fly   133 RDQIQV--------------------IKQVDHRTVFPNPWPAVHASDYFKAFSNDQPILFSPGHV 177
            ..::.:                    :.|:....:..:  ..:|.|..|:|..|..   ..||..
  Rat   140 YGKVNIHSIGFRFSSDLQSMETSTLGLTQISKENIQKS--GKLHLSLPFEARLNAS---MGPGRT 199

  Fly   178 IVLTARCFENKKGQFIIKFMDSDTKREELHFSVRFDEKAVVRNSMNKNFEFGSEERH-GGFPFVF 241
            :|:......|.| .|.:..:...::...||.:.|.:.||.||||..:: .:|.|||: ..|||..
  Rat   200 VVVKGEVNTNAK-SFNVDLVAGRSRDIALHLNPRLNVKAFVRNSFLQD-AWGEEERNITCFPFSS 262

  Fly   242 NQQFKLALAFTEREVLTAVDGYNFFSYTWRTPNAMMNLVGFK-VTSINGLVV 292
            ...|::.:....||...||:|.:...|..|          || ::||:.|.|
  Rat   263 GMYFEMIIYCDVREFKVAVNGVHSLEYKHR----------FKDLSSIDTLAV 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 5..140 CDD:278752 30/156 (19%)
GLECT 172..297 CDD:238025 36/123 (29%)
Lgals8NP_446314.2 Gal-bind_lectin 24..148 CDD:214904 30/131 (23%)
Gal-bind_lectin 194..313 CDD:214904 36/123 (29%)
Beta-galactoside binding. /evidence=ECO:0000250 248..254 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X133
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.