DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5335 and LOC100492008

DIOPT Version :9

Sequence 1:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_002937252.3 Gene:LOC100492008 / 100492008 -ID:- Length:144 Species:Xenopus tropicalis


Alignment Length:141 Identity:36/141 - (25%)
Similarity:67/141 - (47%) Gaps:10/141 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LTEFAGNLSHPLEFGHVLEVVAKTIDGAARFHINLCTAKSTVDPNADIGLRFSCYFRNDVIVRNS 66
            :.::.||:...::....:.::....|....|.|.|....|.:|  .|:.|.....|::..:||||
 Frog    10 VVQYFGNIKGGMKPAMKITIMGIVDDKPKSFAITLLCNPSGLD--QDVALLLRVNFQDKSVVRNS 72

  Fly    67 RINGAWGEEESHVMDPNTLPN-PIVSGEFFLVYILCCEDSFAISINSREFCRFRYRMP-LGTIRA 129
            :..|.||:||..:      |. |..:|:.|.:.|||......::::.|:.|.|.:|:| |..:..
 Frog    73 KFAGIWGKEEGKI------PYFPFTAGDNFKMEILCEHQQMRVTLDGRQLCDFTHRVPQLRAVTG 131

  Fly   130 LEIRDQIQVIK 140
            |.:...|::.|
 Frog   132 LNVSGDIKLTK 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5335NP_611349.2 Gal-bind_lectin 5..140 CDD:278752 35/136 (26%)
GLECT 172..297 CDD:238025
LOC100492008XP_002937252.3 Gal-bind_lectin 19..143 CDD:214904 34/132 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.